PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G412400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 243aa    MW: 28593.9 Da    PI: 8.932
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G412400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569e-18449147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       rg W + Ede+l ++v+++G+++W++Ia+++  gR++k+c++rw++ 
  Aqcoe3G412400.1.p  4 RGHWRPSEDEKLRELVEMYGPHNWNAIAEKLH-GRSGKSCRLRWYNQ 49
                       899*****************************.************96 PP

2Myb_DNA-binding56.56.4e-185699146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                       r ++T+eE+e+l+  ++ +G++ W+ Iar+++ gRt++ +k++w+ 
  Aqcoe3G412400.1.p 56 RSPFTEEEEERLLASHRIHGNR-WAIIARHFP-GRTDNAVKNHWHV 99
                       789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.293150IPR017930Myb domain
SMARTSM007176.7E-16352IPR001005SANT/Myb domain
SuperFamilySSF466898.24E-30497IPR009057Homeodomain-like
PfamPF002491.6E-17450IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-27557IPR009057Homeodomain-like
CDDcd001671.02E-13748No hitNo description
PROSITE profilePS5129426.33451105IPR017930Myb domain
SMARTSM007175.7E-1655103IPR001005SANT/Myb domain
PfamPF002499.7E-155698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2158104IPR009057Homeodomain-like
CDDcd001671.51E-115898No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MCTRGHWRPS EDEKLRELVE MYGPHNWNAI AEKLHGRSGK SCRLRWYNQL DPRINRSPFT  60
EEEEERLLAS HRIHGNRWAI IARHFPGRTD NAVKNHWHVI MARRCRERSR FYAKRAAQNL  120
IDGRRKSLSR TDTGVKIEPR NHSSILEYYK RCSDPIMYNH HANLKNIYSH VPNHCPNSFE  180
DKNHPVEFYD FLQVNTDSNR SEVINHARND QEGEVEQEAK RHLTEESGIQ YIDFLSVGSS  240
VP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-3221055108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279279.11e-109PREDICTED: transcriptional activator Myb
TrEMBLD7SGT61e-109D7SGT6_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g01890.t011e-108(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.14e-86myb domain protein 52